GenomeNet

>bsu:BSU18400 no KO assigned | (RefSeq) yoeD; hypothetical protein (A)
MYLTIEETAEYTNLSEDYIKSLVLEGKIRAVHDGEQFLIYKEQFKTHLEQLENYKALVQE
ILNEPIPEDIDVKDED

BLAST