GenomeNet

>bsu:BSU18590 no KO assigned | (RefSeq) yoaG; hypothetical protein (A)
MKKIASYYLMTLGLSSLTFGLLLGFYSFVMYGDMIIALFTAAIALLYGFVVYGLFAVPLQ
MKLQKKARTFNVMYLLIYSVVAFIAAFLFFVINEPASIAWTLQSYFYYMLSIAAAVIYWL
WDSLILYKRTASGV

BLAST