GenomeNet

>bsu:BSU18970 no KO assigned | (RefSeq) yobI; hypothetical protein (A)
MGEIKKKFVQWLEKLLIRLKEPNVKEESLFEDLSPSNDVDTDGKYSKALSWGLENKKVKN
IALTGPYGSGKSSILNTFQKQYSREYSFLNISLATFNTDTDDMENKLEKSILQQMIYRVH
DRTIPFSRFKRIKHIRTKSIIINLIFFFAFIIVGIYLFKPDALKGIYAETLVSRSLGTED
QQQIRLTILLALFFIVYPLLAYKRIYHFVRANLKLNKVTIANTTLEKNTGEENSSIFDKY
LDEILYFFEASKYNVVIFEDLDRFNNIGIFERLRELNELINNSEQIDRRVVFIYAIKDDI
FGDADTEKLTRDRTKFFDFIIPVIPIINASNSGDILKKKIKHSPYSDLINTHFLEDVTIY
IDDMRVLKNIFNEFVIYQQKLSAIDLDPNKMLAMIIYKNIYPVDFSKLQYNKGLVYEIFQ
KKQLIIEEQIKLINAKIQQLERKLANIEVESLKSIAELNFIYLSELEISNLNSNYDINID
GEVFRGNTSNKDRFFEKLKNADTIYCYLRNRNGPATIKEIATVFGRKPNYFEREDAIKAI
EKNEIQKFKKELLELEREKQEIRAQSLQVLITKMNSKDVFSDKLYEKKLLVYLLRHGYID
EMYNHYITYFYPESLSLSDIKFVFSIKNHESLPYSFELDNIGKIMSKLVGAEFKQIEVLN
FHLLNYIMDHSEYRNYYDSIIERLANGSKESVTFIDGFKERAINKAAFIQSISSKWDDFW
SFIELRSNYTQQKKEEYLSDILTYADIADIIRMNKESVMSFTLSKYLNLLSLVSDEEKIK
ELLLKLQVKFKSLDHLLNSETIYDFVVQRNLYEINIKTLSVILNDAPNITYAAVKNSDQQ
AVINYVNDNIDIFVEKVLLTEEIEEPEESFLELLNREDLDKRVKHAMIMKKTFAISDIGE
LIKELWPIVIRENKMVACWSNVITSYVEYNKKMPDFLIAFLNNPVNRKELSKNNIEAFDD
KFDEAILEDISEEIINSRDITDETFEVLIASIQSWIYFPLGNVSEKRAKLLIDNDLLSLT
PENFKELKLNFDTLHIQLALRNPDEFIDKQGDFSLDANDIKQLIDSNELSQFNKEIFVQH
LNSNCLTDGNNDILKDTIYFINEHNLKITNELLTFLLESPTTLDTRLSLLAGQIKHIDNE
SITEFLTKIGEPYSEIAEKGRRIKISNNRTNKALVTALESKNYISSFKEDRERLRVNTKK
K

BLAST