GenomeNet

>bsu:BSU19000 K21487 toxin YobL [EC:3.1.-.-] | (RefSeq) yobL; hypothetical protein (A)
MKVFEADSLLFEADKRTKEYKELRSQMVKLKKAFKEVANLDDSEFSGKGADNIKAFYHGH
VGVTDQWIDLIDMKIAFLSSMSATLEDAKMSDAYIEESFLEHELANAYAKSKSIMSEQKK
AMKDILNNINDILPLEIFSTEDFKDKLSSADDKREKTIDKLNKLDEDLKTEYAETEPNEQ
FIQQDFKKLQESTGKGKNATPIHYNAKAYRESDIHKKKGDIEKHSEAYLSVKKEEAKERE
IKELKKKLNDGVSDPDEYLEIAKKVGYENLEPTQVQLAVQIEQAKQLEGAGEITWDIVKG
VGVGLYDVGKDTVTGIWDFITDPGETLSALGNAAMHPVKTYDAISAAIEESYQKDMVNGD
AYSRSRWVTYAIGSVAVAVVGTKGAGAINKADAAGKVINKASQAGKKIKDVKIPDLLPYN
PKYKLALADNVPYNVVDSQNLKNELLTNAKKIPDGTRKPFTGQKKSPPWLNKEKYDAYEI
EGKVKAKGKVKDVSRRVYTMKDIDINQKTEFGVTNLQLMKNGNAPYAKDGTQINLHHLIQ
EEPGPMLEIPNSLHTKYSDVIHQLKSDGESFRNDKVLKAQYESFRKRYWKWRAKQFENEN

BLAST