GenomeNet

>bsu:BSU19300 no KO assigned | (RefSeq) yozC; hypothetical protein (A)
MIHKNWLEKETIKKVKCVQTNAKKYIVNRVLTPGKEYEVKNETEEFLFVVDNTNKVGGYY
KEYFEEM

BLAST