GenomeNet

>bsu:BSU19940 no KO assigned | (RefSeq) yotB; hypothetical protein (A)
MKIDYVSDLHINHWIPWNVNQIKWEKRTREIVNRLISNGNGEVLVIAGDFTEWNQQTLWV
LDEAAKQYEKVYFTYGNHDLYLLSKSQKRKYSDSLGRLNDLIQKAADMKNVTPLIKTTET
YKGKVFAGDVMWYLPKGIEGWDFFKGVSNDSNYIWLNGYNKVDGVRAMWKESMDWYETLE
NTQVDVFVSHVPPVHNPYSPFEPNTCYMVDVPFINAKHWVCGHDHLQAEFDKDGTSFHMN
CIGYPYDYDNYPSVNVIPGEEVDSYKTFELKTFEI

BLAST