GenomeNet

>bsu:BSU20070 K03647 protein involved in ribonucleotide reduction | (RefSeq) nrdI; ribonucleotide reductase stimulatory protein NrdI (A)
MTYESKTGNVKRFVKALQQEFDVEAIEITDDTIINQEFIHITYTIGFGEVPERTLSFINK
NKNKIRGVAVSGNKVWGDNYGLAGDKLSAKFHTPLLLKFELSGTKQDLQKIIQEVQLIDK
HNTKLDQAQ

BLAST