GenomeNet

>bsu:BSU20170 no KO assigned | (RefSeq) yosC; hypothetical protein (A)
MISRASAVYDKLKQAERNIRGDESMQTLDAPIYEVKQESDWYKSEKKRKEDINSFFDKFE
EKYGVKEGFSFYHSEYFGVYEGTEAYEIFKNDIVKNQVDGFYAFKKRSKYFKEIKAMIEQ
IEEVYPFRSHDELGLNNMTGRQWIGDRWFFGVKTEQLVNGDSVVATDYKDYLKIVMEHLD

BLAST