GenomeNet

>bsu:BSU20260 no KO assigned | (RefSeq) yorT; hypothetical protein (A)
MERFIKRLSASCESTIHHKVYQIMNEAKTEFEKVLKKLK

BLAST