GenomeNet

>bsu:BSU20310 no KO assigned | (RefSeq) yorO; hypothetical protein (A)
MKCIQIEMSFTDEYGQVTRLNKTYKPSIIEEHKGEIPRLLLDDFKRFLSSLGFNEKQVSR
IVTED

BLAST