GenomeNet

>bsu:BSU20480 no KO assigned | (RefSeq) yoqX; hypothetical protein (A)
MPQQTVEVKEVDVLIRGIWRKKKFTDIQKGQTFKIEENGRTKKYIARTDPYWDDMFETYI
IDLLDKNKIRRNK

BLAST