GenomeNet

>bsu:BSU20490 no KO assigned | (RefSeq) yoqW; hypothetical protein (A)
MCGRFTLFSEFDDIIEQFNIDQFLPEGEYHPSYNVAPSQNILTIINDGSNNRLGKLRWGL
IPPWAKDEKIGYKMINARAETLSEKPSFRKPLVSKRCIIPADSFYEWKRLDPKTKIPMRI
KLKSSNLFAFAGLYEKWNTPEGNPLYTCTIITTKPNELMEDIHDRMPVILTDENEKEWLN
PKNTDPDYLQSLLQPYDADDMEAYQVSSLVNSPKNNSPELIESH

BLAST