GenomeNet

>bsu:BSU20640 no KO assigned | (RefSeq) yoqG; hypothetical protein (A)
MEKMNLLKEITIFDLNKIKPGTKVQVTWYKGTEMEYTHNGEVIINNGEKFYYNYVDKEGY
VGHCHVNALDLKNYPDSLIVEIKSK

BLAST