GenomeNet

>bsu:BSU20730 no KO assigned | (RefSeq) yopX; hypothetical protein (A)
MNTAYRVWDGEQMHYWDDEGLSLIIKSNGDWTLKRLYTDVLVPVVDSTNRNAALMWGAKV
RGKFIYDRSIVKITSDDKESSDVCEVKFSDGVFQVDVSKISADYDVTAVGWVEYATIEVI
GDVYQNPELLEGVK

BLAST