GenomeNet

>bsu:BSU21160 no KO assigned | (RefSeq) yonA; hypothetical protein (A)
MTEKIKLARYRSTSYFVGYTGDGGHKQYTWSGSKNGKADIKEVPKEVVEWLTMNSVCFDK
GELVIVEDNETTKEIKDSIVESEAYENNIHTKEEIEKMIKSGNIAQLKNKLDKITVDSEK
QFIIDVASEFSDDIAAGKLKVLADWMGVADPSLLFD

BLAST