GenomeNet

>bsu:BSU21200 no KO assigned | (RefSeq) yomW; hypothetical protein (A)
MSMTVEQMTKVFRLVMDDVELNRLLYYKTDPLSPSHPDVQSLENYYDSTNDSPAIINTIF
KRAPKTDDLSDSPLCRMCIYLGNALPKPTNQSFMLLNQELMIDVYTHINTFEISEYRSLK
IIDRVSKLFFNKNIAGFGVTVDYKRLLISNPPDGYLGYKMIFTFGASK

BLAST