GenomeNet

>bsu:BSU21390 no KO assigned | (RefSeq) yomE; hypothetical protein (A)
MAGFYRYDQNLDKYVPMPVELLASEGEEYTAPKITQKFNEVETKTTEILNKVLTDDRYFT
VTSSFKQDATLGIEYYVTKVTPKTTEAKKSMVQKTFAYDFEKSIDPTSSYFGTTNRETVL
SMAKRKRSVVAINASGWRSNGEVMGLQIKDGVLYKDYDAAGYTGAEACVFFDDGTMKVYG
NREVDADILISKGARNSFAFGIWLVKDSKPRTAQMTTWADLNVKHPRQAIGQRSDGTLVI
ITVDGRSLRSSGITAYDMPSLFLSEGCINAFLLDGGGSSQTAVEGKYINNISDGIERAVV
DTLTISYPDDDTDSRFFEVQEGRGLATSLNRRVEFIESKPTWNVLDLGFSPDGLIDNTAK
FKKALSDLSEKGGGKLHFPKGTYLIGKQNTTSASEKIELPSNVSIVGERRSYTKLLRNPN
HSLDELLRITDHNYIEGIEIDGNSSVNKSSCRLIAGGNIKSFKMKDCSLVNATDRGVSIH
GIGKSITIEGMYISNIANECINVAEGEIIKLIDSEITFSGTALWVGNAANIFTKNNLAKS
LKTFVRYKNSQNAICSGNIITNNIDRAIWGSVREAVFSDNVFKQCHSDYHLYFIQEDTGT
NDLIVTGNSVYSDVEGTAFIRTPSDIDRRRVSGNVGNIPSLNLD

BLAST