GenomeNet

>bsu:BSU21600 no KO assigned | (RefSeq) yokG; pesticidal crystal protein-like YokG (A)
MKYDNLLDATSQYGPQDLLLGRDGLISTGYWAKTQANILTGTGLPVSNDEMKTYLNLPKN
VEIPQDFQKLYDVYNEYKKLCDWWLEKLLSCVNKMANDIYNVGSTTSELINEALQPGLRA
ITTASNDQDRQDAIQDFHEVCLILMRELDENQQSMKDVQNLLNSFLQGGNNFIGVTQLNN
SFEEVMTYLDSQYNDESEIHDLLNIFMQFKKLLGESLEEHEINEKVKFSSELGPLIGYIV
SEMLEYSDVQMFKQRIDNFQNLNGVDAQVALVVKVLSLFHGINIDLHNVIYQAERSLEFI
EQTEGNWHSIANQFYSLAQGFENEDINKLSTDLDNAAATWEAVANKAKEFVTNSYQG

BLAST