GenomeNet

>bsu:BSU21800 no KO assigned | (RefSeq) ypkP; hypothetical protein (A)
MVRYSLLVVYIVYMLLKNMKQLFNQTMLDPRLSYKKQMALVYEQPKAFLEGCIGISGSVV
TIHQPEPIPHGPVLYVHPRLRLAELALIAGYIEEPAGFIANPKVFRLPFIGQWLDRMDVI
SDGDSEKVYEDVTKQLEKGQSLILSLDGSIDPVELAARYHLPLVMVETKGTDNMQNGSFF
KRLKPADIELSFSKAYIPANEKQLRA

BLAST