GenomeNet

>bsu:BSU21860 no KO assigned | (RefSeq) yphP; hypothetical protein (A)
MSMAYEEYMRQLVVPMRRELTGAGFEELTTAEEVENFMEKAEGTTLVVVNSVCGCAAGLA
RPAATQAVLQNDKTPDNTVTVFAGQDKEATAKMREYFTGQEPSSPSMALLKGKEVVHFIP
RHEIEGHDMEEIMKNLTAAFDAHC

BLAST