GenomeNet

>bsu:BSU21990 K03469 ribonuclease HI [EC:3.1.26.4] | (RefSeq) ypdQ; ribonuclease H-like protein (A)
MPTEIYVDGASAGNPGPSGIGIFIKHEGKAESFSIPIGVHTNQEAEFLALIEGMKLCATR
GYQSVSFRTDSDIVERATELEMVKNITFQPFVEEIIRLKAAFPLFFIKWIPGKQNQKADL
LAKEAIRLNEKN

BLAST