GenomeNet

>bsu:BSU22180 no KO assigned | (RefSeq) ypsB; cell cycle protein GpsB (A)
MLADKVKLSAKEILEKEFKTGVRGYKQEDVDKFLDMIIKDYETFHQEIEELQQENLQLKK
QLEEASKKQPVQSNTTNFDILKRLSNLEKHVFGSKLYD

BLAST