GenomeNet

>bsu:BSU22270 no KO assigned | (RefSeq) yppE; hypothetical protein (A)
MLSQTLLEMTEQMIEVAEKGADRYQEGKNSNHSYDFFETIKPAVEENDELAARWAEGALE
LIKVRRPKYVHKEQIEAVKDNFLELVLQSYVHHIHKKRFKDITESVLYTLHAVKDEIARE
DSR

BLAST