GenomeNet

>bsu:BSU22540 K03888 menaquinol-cytochrome c reductase cytochrome b/c subunit | (RefSeq) qcrC; menaquinol-cytochrome c reductase cytochrome b/c subunit (A)
MHRGKGMKFVGDSRIPAEKKPNIPKDYSEYPGKTEAFWPNFLLKEWMVGAVFLIGFLVLT
IVHQPPLERMADPTDTGYIPLPDWYFLFLYQLLKYEYAAGSFTVVGAMIMPGLAFGALLL
APFLDRGTERRPWKRPVAVGMMLLAISAAVFLTWQSVATHDWAKAEEQGKITKEADIDTN
AEGYKVFKEQGCISCHGDNLQGGAAGPSLVDSGLKPDEIKKIAVEGKGKMPAGVFKGNDK
QLEELAKFISETTAK

BLAST