GenomeNet

>bsu:BSU22560 K03886 menaquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.-] | (RefSeq) qcrA; menaquinol-cytochrome c reductase iron-sulfur subunit (A)
MGGKHDISRRQFLNYTLTGVGGFMAASMLMPMVRFALDPVLKSTGKQDMVQVVSVDELTK
EPQRFDFKINQVDAWYESEESRSAWVFKNGDEIVALSPICKHLGCTVNWNSDPKNPNKFF
CPCHYGLYEKDGTNVPGTPPLAPLDHYEQEVKDGFLYLGKAKPKGEG

BLAST