GenomeNet

>bsu:BSU22880 K02945 small subunit ribosomal protein S1 | (RefSeq) rpsA; 30S ribosomal protein S1 (A)
MTEEMNQIDVQVPEVGDVVKGIVTKVEDKHVDVEIINVKQSGIIPISELSSLHVEKASDV
VKVDDELDLKVTKVEDDALILSKRAVDADRAWEDLEKKFETKEVFEAEVKDVVKGGLVVD
IGVRGFIPASLVEAHFVEDFTDYKGKTLSLLVVELDRDKNRVILSHRAVVESEQANKKQE
LLQSLEVGSVLDGKVQRLTDFGAFVDIGGIDGLVHISQLSHSHVEKPSDVVEEGQEVKVK
VLSVDRDNERISLSIKDTLPGPWNQIGEKVKPGDVLEGTVQRLVSFGAFVEILPGVEGLV
HISQISNKHIGTPHEVLEEGQTVKVKVLDVNENEERISLSMRELEETPKADQEDYRQYQA
KEETSTGFQLGDLIGDKLNKLK

BLAST