GenomeNet

>bsu:BSU22920 K06313 spore germination protein | (RefSeq) ypeB; sporulation protein YpeB (A)
MIRGILIAVLGIAIVGTGYWGYKEHQEKDAVLLHAENNYQRAFHELTYQVDQLHDKIGTT
LAMNSQKSLSPALIDVWRITSEAHNSVSQLPLTLMPFNKTEELLSKIGDFSYKTSVRDLD
QKPLDKNEYTSLNKLYQQSEDIQNELRHVQHLVMSKNLRWMDVEMALASDEKQSDNTIIN
SFKTVEKNVGAFSTGTDLGPSFTSTKKEEKGFSHLKGKQISEQEAKQIAERFAPDDNYSI
KVVKSGKKTNRDVYSISMKDPDHKAVIYMDITKKGGHPVYLIQNREVKDQKISLNDGSNR
ALAFLKKNGFETDDLEIDESAQYDKIGVFSYVPVENKVRMYPEAIRMKVALDDGEVVGFS
ARDFLTSHRKRTIPKPAITEAEAKSKLNKNVQVRETRLALITNELGQEVLCYEMLGTIEN
DTFRMYINAKDGSEEKVEKLKNAEPIYKDL

BLAST