GenomeNet

>bsu:BSU22930 K01449 N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28] | (RefSeq) sleB; spore cortex-lytic enzyme (A)
MKSKGSIMACLILFSFTITTFINTETISAFSNQVIQRGATGDDVVELQARLQYNGYYNGK
IDGVYGWGTYWAVRNFQDQFGLKEVDGLVGAKTKQTLICKSKYYREYVMEQLNKGNTFTH
YGKIPLKYQTKPSKAATQKARQQAEARQKQPAEKTTQKPKANANKQQNNTPAKARKQDAV
AANMPGGFSNNDIRLLAQAVYGEARGEPYEGQVAIAAVILNRLNSPLFPNSVAGVIFEPL
AFTAVADGQIYMQPNETAREAVLDAINGWDPSEEALYYFNPDTATSPWIWGRPQIKRIGK
HIFCE

BLAST