GenomeNet

>bsu:BSU23000 no KO assigned | (RefSeq) ypbE; hypothetical protein (A)
MTNMSRVERRKAQNLYEDQNAALADDYVDDGESLPTRQSVKNQREQKKKQGKTKTPLFTV
LAVIFVFVPVIVLVTLFYLKSHPDNHDDYEDVFIDSSQSKYEVVPKSEDKNDTADTKETA
LQKESKKEPEDSKPKEQTAADKKQTAVAEKEDSPNKEEATAAAASSSQSTVQQQEQPAEP
VQNVPNRVVKHTVQKKETLYRISMKYYKSRTGEEKIRAYNHLNGNDVYTGQVLDIPLMDE

BLAST