GenomeNet

>bsu:BSU23240 K02859 riboflavin biosynthesis RibT protein | (RefSeq) ypzK; riboflavin biosynthesis protein RibT (A)
MLIRYKKSFEKIAMGLLSFMPNEKDLKQLQQTIKDYETDTDRQLFLWKEDEDIVGAIGVE
KKDSEVEIRHISVNPSHRHQGIGKQMMDALKHLFKTQVLVPNELTQSFFERCQGQQDQDI
SYNN

BLAST