GenomeNet

>bsu:BSU23260 K14652 3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25] | (RefSeq) ribA; riboflavin biosynthesis protein RibBA (A)
MFHPIEEALDALKKGEVIIVVDDEDRENEGDFVALAEHATPEVINFMATHGRGLICTPLS
EEIADRLDLHPMVEHNTDSHHTAFTVSIDHRETKTGISAQERSFTVQALLDSKSVPSDFQ
RPGHIFPLIAKKGGVLKRAGHTEAAVDLAEACGSPGAGVICEIMNEDGTMARVPELIEIA
KKHQLKMITIKDLIQYRYNLTTLVEREVDITLPTDFGTFKVYGYTNEVDGKEHVAFVMGD
VPFGEEPVLVRVHSECLTGDVFGSHRCDCGPQLHAALNQIAAEGRGVLLYLRQEGRGIGL
INKLKAYKLQEQGYDTVEANEALGFLPDLRNYGIGAQILRDLGVRNMKLLTNNPRKIAGL
EGYGLSISERVPLQMEAKEHNKKYLQTKMNKLGHLLHF

BLAST