GenomeNet

>bsu:BSU23300 no KO assigned | (RefSeq) ypuD; hypothetical protein (A)
MGRIKTKITILLVLLLLLAGGYMYINDIELKDVPTAIGQTLSSEEEEYTIQEYKVTKIDG
SEYHGVAENGTKIIFNGKKLNQDLSDIKEGDKIKAYFSKSKRIDGLIKVAKVND

BLAST