GenomeNet

>bsu:BSU23900 K09166 uncharacterized protein | (RefSeq) yqjF; hypothetical protein (A)
MTERFQQKNISVPDGIWIMRQTWNDVLFAHWPVDVSILRALVPSVLELDTYNGQAWISML
PFMLTNLRARYLPVIPGARAFPELNLRTYVTYKGKPGIYFFSLDADHRLAVLGARTFFHL
PYFYADMKSEKNGDAIDYVSKRKNDKEAAFHAAYRPISAPFTAEKDSLDYWLTERYRLYT
TYRNKLYYEDIHHHPWLLQNAEAEISVNTVTDAHGITLPESDPLLHYAKKQDVLFWPLRK
WS

BLAST