GenomeNet

>bsu:BSU24040 K00167 2-oxoisovalerate dehydrogenase E1 component beta subunit [EC:1.2.4.4] | (RefSeq) bkdAB; 2-oxoisovalerate dehydrogenase subunit beta (A)
MSVMSYIDAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLYEQFGEERVMDTPLAE
SAIAGVGIGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYG
GGVHGALYHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYRLI
KGEVPADDYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLRTVY
PLDKEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFDLDAPIKRLAGPDIPAM
PYAPTMEKYFMVNPDKVEAAMRELAEF

BLAST