GenomeNet

>bsu:BSU24050 K00166 2-oxoisovalerate dehydrogenase E1 component alpha subunit [EC:1.2.4.4] | (RefSeq) bkdAA; 2-oxoisovalerate dehydrogenase subunit alpha (A)
MSTNRHQALGLTDQEAVDMYRTMLLARKIDERMWLLNRSGKIPFVISCQGQEAAQVGAAF
ALDREMDYVLPYYRDMGVVLAFGMTAKDLMMSGFAKAADPNSGGRQMPGHFGQKKNRIVT
GSSPVTTQVPHAVGIALAGRMEKKDIAAFVTFGEGSSNQGDFHEGANFAAVHKLPVIFMC
ENNKYAISVPYDKQVACENISDRAIGYGMPGVTVNGNDPLEVYQAVKEARERARRGEGPT
LIETISYRLTPHSSDDDDSSYRGREEVEEAKKSDPLLTYQAYLKETGLLSDEIEQTMLDE
IMAIVNEATDEAENAPYAAPESALDYVYAK

BLAST