GenomeNet

>bsu:BSU24340 K01961 acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14] | (RefSeq) accC; acetyl-CoA carboxylase biotin carboxylase subunit (A)
MIKKLLIANRGEIAVRIIRACRELGIETVAVYSEADKDALHVQMADEAFCIGPKASKDSY
LNVTNIVSVAKLTGTDAIHPGYGFLAENADFAELCEEVNVTFVGPSADAISKMGTKDVAR
ETMKQAGVPIVPGSQGIIENVEEAVSLANEIGYPVIIKATAGGGGKGIRVARTEEELING
IKITQQEAATAFGNPGVYIEKYIEDFRHVEIQVLADNYGNTIHLGERDCSIQRRLQKLLE
ESPSPALDSEIREQMGDAAVKAAKAVGYTGAGTVEFIYDYNEQRYYFMEMNTRIQVEHPV
TEMVTGTDLIKEQIKVASGMELSLKQEDVEFEGWAIECRINAENPSKNFMPSPGEIKMYL
PPGGLGVRVDSAAYPGYSIPPYYDSMIAKVITYGKTRDEAIARMKRALSEFVIEGIETTI
PFHLKLLEHETFVSGEFNTKFLETYDVMGS

BLAST