GenomeNet

>bsu:BSU25000 K21465 penicillin-binding protein A | (RefSeq) pbpA; hypothetical protein (A)
MRRNKPKKQNHKEKKKSLPIRLNILFLAAFVIFTWIIVELGIKQIVQGDDYKNQANKQEQ
SEVSSAVPRGKIYDRNFNAIVTNKALNAITYTRSKSTTQEQRLKIAKKLSDMIKVDTKKV
TERDKKDYWILTRPKEAKKLISSKERQQVEDKKISDDDLYQLQLKRITDKQLNELTDKDM
QILAIKRQMDSGYALTPQYIKNEDVSAKEMAVVSEHLDELPGVDVTSDWEREYPYKNLLR
SVLGSVSSSNEGLPSNLLDHYLSLGYSRNDRVGKSYLEYQYESLLQGQKAKVENITDSKG
NVTGTKTVSEGKAGKDLVLTIDIDLQKSVEKIIEKKLKAAKARPSTELLDRAFVVMMDPR
NGEVLTMAGKQIKRENGAYKFDDYALGAMTSSYAMGSAVKGATVLTGLQTGAINLNTVFK
DEPLYIGQDKRGKKSWQNLGPVGIQTALEKSSNVFMFKTAIAVGKGEYKPHQALPLDTSA
FDTFRNYFSQFGLGVKTGIDLPNEMTGYKGTSRLSGFLLDFAIGQYDTYTPLELAQYVST
IANGGYRMKPQLVKEVRDSNAKKGIGAVVDSVQPEVLNKVDMKSSYIEEVQAGFRRVATK
GTAAGQLASASYKPAAKTGTAQSFYDGPDKSKTGTDTYNTTLVAYAPADNPEIAISVVVP
WTYIDYNQRYSITNEIGREVMDKYFELKSKQDKEGTQQKNKDKIEENAENTTSSDN

BLAST