GenomeNet

>bsu:BSU25040 no KO assigned | (RefSeq) yqgB; hypothetical protein (A)
MNVFQLFIKSTYSPRDIAKTRFQGIGKAILYVFLLSVLFAIPTAYYVSTGTVKSMNGFKT
VLNKDFPDFTISNGKLQTDEKKATESQANGFVIVFDPTDSYGTEQIEAKQNAIGILQNKF
VLAIDGQAQEMSYSMMPSELQKKDVIAGLNQNKAMIVTVLSALIFLVTAAGKFIEVSFLA
LIGLIIKNSQKKHLSYHQLWKLSAYSITLSTVFFTIMRALEATVPSEFLLNWFVNFVILF
LVLKEIPSKKVINKS

BLAST