GenomeNet

>bsu:BSU25260 K01879 glycyl-tRNA synthetase beta chain [EC:6.1.1.14] | (RefSeq) glyS; glycine--tRNA ligase beta subunit (A)
MSKQDLLLEIGLEEMPARFLNESMVQLGDKLTGWLKEKNITHGEVKLFNTPRRLAVFVKD
VAEKQDDIKEEAKGPAKKIALDADGNWTKAAIGFSKGQGANVEDLYIKEVKGIEYVFVQK
FQAGQETKSLLPELSGLITSLHFPKNMRWGNEDLRYIRPIKWIVALFGQDVIPFSITNVE
SGRTTQGHRFLGHEVSIESPSAYEEQLKGQHVIADPSVRKQMIQSQLETMAAENNWSIPV
DEDLLDEVNHLVEYPTALYGSFESEFLSIPEEVLVTTMKEHQRYFPVKDKNGDLLPHFIT
VRNGNSHAIENVARGNEKVLRARLSDASFFYKEDQKLNIDANVKKLENIVFHEELGSLAD
KVRRVTSIAEKLAVRLQADEDTLKHVKRAAEISKFDLVTHMIYEFPELQGIMGEKYARML
GEDEAVAAAVNEHYMPRSAGGETPSTFTGAVVAMADKLDTIASFFSIGVIPTGSQDPYGL
RRQASGIVAILLDRNWGISFEELLTFVQTDKENELLDFFTQRLKYVLNAEQIRHDVIDAV
LESSELEPYSALHKAQVLEQKLGAPGFKETAEALGRVISISKKGVRGDIQPDLFENEYEA
KLFDAYQTAKQNLQENFSKKDYEAALASLAALKEPIDAYFDHTMVIADNESLKANRLAQM
VSLADEIKSFANMNALIVK

BLAST