GenomeNet

>bsu:BSU25340 K06217 phosphate starvation-inducible protein PhoH and related proteins | (RefSeq) phoH; PhoH-like protein (A)
MTEHLLAMNQKLKNPDEALSLFGNQDSFLKLMEKDLNLNIITRGETIYVSGDDESFQIAD
RLLGSLLALIRKGIEISERDVIYAIKMAKKNELEYFESMYEEEITKNAKGKSIRVKTMGQ
REYVAAMKRNDLVFGIGPAGTGKTYLAVVKAVHALKNGHIKKIILTRPAVEAGESLGFLP
GDLKEKVDPYLRPLYDALHDVLGADHTERLMERGIIEIAPLAYMRGRTLDDAYVILDEAQ
NTTPAQMKMFLTRLGFGSKMIITGDVSQIDLPKGVKSGLAVAKEMLKGIDGISMIELDQT
DVVRHPLVAKIIEAYDKQN

BLAST