GenomeNet

>bsu:BSU25650 K07574 RNA-binding protein | (RefSeq) yqeI; RNA-binding protein YqeI (A)
MLTGKQKRFLRSKAHHLTPIFQVGKGGVNDNMIKQIAEALEARELIKVSVLQNCEEDKND
VAEALVKGSRSQLVQTIGNTIVLYKESKENKQIELP

BLAST