GenomeNet

>bsu:BSU25820 K09190 uncharacterized protein | (RefSeq) yqcI; hypothetical protein (A)
MTELYAKSDLEKIKETLPGWQLDSFNYLNEKIGDKENKFPCIPGRQAFLSDQLRIAFVGD
PRNPETAKELAPLLTRYGTISRETGKYASLTVIFHTPEELLTDYKIEDYESLFWQLLNSL
SMEDPADWPDDIPENPDNFQWEYCFNGEPYFVLCATPAHSKRKSRSFPYFMLTFQPRWVF
EDLNDTTAFGRNMSKQIRKRLEAYDEVPIHPHLGWYGKKDNLEWKQYFLRDDENQVSQCP
FMKMKNLFKKKRSD

BLAST