GenomeNet

>bsu:BSU25880 no KO assigned | (RefSeq) yqxJ; hypothetical protein (A)
MVTVEERLDNLEKKVEKQAFQLRLVQQLAADYDRFGLFDQVLAYDLSEKQYQELRELTSQ
YTDKIKNGEEVSLHNFTEEFKRILKDIEKEVDFEKFISLWLKGPEEGFGFSKALHNHFFN

BLAST