GenomeNet

>bsu:BSU25940 no KO assigned | (RefSeq) yqcD; hypothetical protein (A)
MNIGEAILFKYPTADPTKDFIVQNNGDGTPSYIAEWNIRAPIPTEAELKTWWEELQSTSA
YEPPVQVDLLARELSQEKLARKQLEELNQTLGSELSKIKLQLLTLQGGQGS

BLAST