GenomeNet

>bsu:BSU25970 no KO assigned | (RefSeq) yqcA; hypothetical protein (A)
MSKLDEMTAYLPPFLTKLKEMAELLKAEAPEFEKQNNSIFDLTDQLFVTTATWGLERWEK
ILNVPRESGDTDEIRRLRLISKMSNIPPATYRAIEHALNRFLKNPSAQVRLLPGEYRFKV
DIDIDDMQHMSELIETLENMKPAHLAYTLRAALNEPLQIKDTVILNNRRYRKASELKVGY
SVTLNNNEVVLV

BLAST