GenomeNet

>bsu:BSU26560 no KO assigned | (RefSeq) yrkC; hypothetical protein (A)
MYYNPFSPQCYYYVTVPMYNDGRSVYWTIPNEMEKVHRGADLRSSYEDRNLLLKDYGPKP
FVVNINRATKQNNTFRTALWTGKHFQVTLMSLGIGEDIGLEIHPNVDQFLRIEQGRGIVK
MGKSKDHLNFQRNVYDDSAIVVPAGTWHNVINTGNTPLKLYSIYAPPNHPFGTVHETKAD
AVAAED

BLAST