GenomeNet

>bsu:BSU26980 no KO assigned | (RefSeq) yraE; hypothetical protein (A)
MEYALHEVLEVQEMTAFKTLCLTKSKTMKALVSDPKLKEIMQQDVDITTRQLQEFASILS
NAKQE

BLAST