GenomeNet

>bsu:BSU27070 K11194 PTS system, fructose-specific IIA component [EC:2.7.1.202] | (RefSeq) levD; PTS system-fructose-specific transporter subunit IIA (A)
MISVIISGHGDFPIALKESSGMIFGEENNLIAVPFFKGEGIQTLQEKYHQALKDIPEEHE
VLFLVDIFGGTPYNAAASFIAEDQRMDMAAGVNLPILLEVLSLREHLALKDLLNNLKAMS
QQSFQVCSEHLEKVKTANQDTREDEL

BLAST