GenomeNet

>bsu:BSU27110 K23356 HTH-type transcriptional regulator, sugar sensing transcriptional regulator | (RefSeq) yrhO; hypothetical protein (A)
MKENMLDILKNLNFTEYESKAYLALLQESPLTGYAVAKKSGVPRSKIYEVLESLVIRGDV
FVSHGNTPQYVPVPAKELIKNRRLKAEEHFDQAEKYFEKFEQTANDRENIWNITGRSEIL
EKVKACILSAKKRILLEIWKEDFKEIEAELKQAAEQGVIVTIIAYGDIVSDFANVYLHDM
SSEITEEYDGRWLVYSGDDSEVVAGIVSLGNDSRAAWTMHVGLVMPITEVIIHDLYLMEI
LKKHRELLEESFGKNLIQLRRKFSIHSDFKKHYLE

BLAST