GenomeNet

>bsu:BSU27150 no KO assigned | (RefSeq) yrhK; hypothetical protein (A)
MKGNEEHDIQKELKRYELFFKKRYKVLYTVNDFIIGAMFLVGSFFFFYDRLMSAGIWLFA
IGSLLLLIRPTIRLIHDFHYRKHVEQQFKHQSSTDD

BLAST